Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q4G0N8-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-34 (28) EFFFSTEDLPEVILTLSLISSIGAFLNR PA
1
35-66 (32) HLEDFPIPVPVILFLLGCSFEVLSFTSSQVQR PA
1
67-81 (15) YANAIQWMSPDLFFR PA
1
82-102 (21) IFTPVVFFTTAFDMDTYMLQK PA
1
103-159 (57) LFWQILLISIPGFLVNYILVLWHLASVNQLLLKPTQWLLFSAILVSSDPMLTAAAIR PA
1
166-195 (30) SLISLINGESLMTSVISLITFTSIMDFDQR PA
1
201-228 (28) NHTLAEEIVGGICSYIIASFLFGILSSK PA
1
229-283 (55) LIQFWMSTVFGDDVNHISLIFSILYLIFYICELVGMSGIFTLAIVGLLLNSTSFK PA
1
284-306 (23) AAIEETLLLEFLTLLLISPVLSR PA
0
307-314 (8) VGHEFSWR PA
1
315-325 (11) WIFIMVCSEMK PA
1
326-347 (22) GMPNINMALLLAYSDLYFGSDK PA
1
350-368 (19) SQILFHGVLVCLITLVVNR PA
1
369-381 (13) FILPVAVTILGLR PA
1
390-403 (14) SVCCTFQHFQELTK PA
1
414-425 (12) DLANADWNMIEK PA
1
426-445 (20) AITLENPYMLNEEETTEHQK PA
1
454-469 (16) EIDEIFNTEAMELANR PA
1
471-481 (11) LLSAQIASYQR PA
1
485-506 (22) NEILSQSAVQVLVGAAESFGEK PA
1
510-517 (8) CMSLDTIK PA
1
532-541 (10) LLLNWVYNTR PA
1
555-597 (43) ICHTIVFTEEFEHVGYLVILMNIFPFIISWISQLNVIYHSELK PA
1
598-614 (17) HTNYCFLTLYILEALLK PA
1
621-651 (31) DFFSHAWNIFELAITLIGILHVILIEIDTIK PA
1
652-664 (13) YIFNETEVIVFIK PA
1
695-702 (8) TFWYGILK PA
1
703-722 (20) GYVQGEADIMTIIDQITSSK PA
1
742-758 (17) ELGYLEYDHPEIAVTVK PA
1
761-775 (15) EEINVMLNMATEILK PA
1
786-793 (8) TEGAGINK PA
1
801-826 (26) EVLDSQSIIRPLTVEEVLYHIPWLDK PA
1
829-837 (9) DYINFIQEK PA
1
840-857 (18) VVTFDCGNDIFEEGDEPK PA
1
858-868 (11) GIYIIISGMVK PA
1
872-885 (14) SKPGLGIDQMVESK PA
1
888-915 (28) DFPIIDTDYMLSGEIIGEINCLTNEPMK PA
1
922-931 (10) TVVETCFIPK PA
1
932-946 (15) THLYDAFEQCSPLIK PA
1
953-960 (8) LGLAITAR PA
1
964-978 (15) EHLSYEDWNYNMQLK PA
1
979-992 (14) LSNIYVVDIPMSTK PA
1
993-1016 (24) TDIYDENLIYVILIHGAVEDCLLR PA
1
1021-1040 (20) APFLIPITCHQIQSIEDFTK PA
1
1041-1051 (11) VVIIQTPINMK PA
1
1066-1087 (22) SYLTPGLIGSVGTLEEGIQEER PA
1
1091-1101 (11) EDGAHSAATAR PA
1
1102-1112 (11) SPQPCSLLGTK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center