Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q4ZIN3-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-25 (25) MSEHVEPAAPGPGPNGGGGGPAPAR PA
1
29-41 (13) TPNLNPNPLINVR PA
1
44-51 (8) LFHALFFK PA
1
67-75 (9) LFEFFVLLK PA
1
76-92 (17) ALFVLFVLAYIHIVFSR PA
1
93-102 (10) SPINCLEHVR PA
1
122-134 (13) APVFLQFCDSGGR PA
1
135-169 (35) GSFPGLAVEPGSNLDMEDEEEEELTMEMFGNSSIK PA
1
170-177 (8) FELDIEPK PA
1
178-202 (25) VFKPPSSTEALNDSQEFPFPETPTK PA
1
203-221 (19) VWPQDEYIVEYSLEYGFLR PA
1
230-243 (14) LSIPVMVVTLDPTR PA
1
254-271 (18) LLLDEFLGYDDILMSSVK PA
1
272-280 (9) GLAENEENK PA
1
285-293 (9) NVVSGEHYR PA
1
294-301 (8) FVSMWMAR PA
1
302-323 (22) TSYLAAFAIMVIFTLSVSMLLR PA
1
324-401 (78) YSHHQIFVFIVDLLQMLEMNMAIAFPAAPLLTVILALVGMEAIMSEFFNDTTTAFYIILIVWLADQYDAICCHTSTSK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center