Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q53FD0-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-31 (25) LASHLPVGVMLPHNTTEAPGPHSAK PA
1
32-46 (15) QDSYEQGDSSQQSLK PA
1
82-119 (38) SYSYPHCTGISQQDPESDSQGQGNGLFYSSGPQSWYPK PA
1
120-130 (11) ANNQDFIPFTK PA
1
138-147 (10) AFPLKPMVHR PA
1
149-171 (23) SCSTGEAGTDGDHNVYPRPPEPR PA
1
182-200 (19) NQGNFSVVGTVLAATQAEK PA
1
216-228 (13) LEAAGESLEEEIR PA
1
257-265 (9) ENENGELQK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center