Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q53G59-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-16 (11) FEASVGFLDVK PA
0
29-46 (18) THFVLSPHCFMGGIMAPK PA
0
47-55 (9) DIMTNTHAK PA
1
56-65 (10) SILNSMNSLR PA
1
67-76 (10) SNTLCDVTLR PA
1
87-107 (21) IVLAACSDYFCAMFTSELSEK PA
1
108-154 (47) GKPYVDIQGLTASTMEILLDFVYTETVHVTVENVQELLPAACLLQLK PA
1
158-177 (20) QACCEFLESQLDPSNCLGIR PA
1
178-198 (21) DFAETHNCVDLMQAAEVFSQK PA
1
199-219 (21) HFPEVVQHEEFILLSQGEVEK PA
1
223-243 (21) CDEIQVDSEEPVFEAVINWVK PA
1
250-261 (12) EESLPNLLQYVR PA
1
269-281 (13) YITDVIDAEPFIR PA
1
296-303 (8) FHLRPELR PA
1
315-339 (25) LGANEVLLVVGGFGSQQSPIDVVEK PA
1
344-355 (12) TQEWSFLPSITR PA
1
359-368 (10) YVASVSLHDR PA
1
369-378 (10) IYVIGGYDGR PA
1
381-406 (26) LSSVECLDYTADEDGVWYSVAPMNVR PA
1
408-429 (22) GLAGATTLGDMIYVSGGFDGSR PA
1
437-454 (18) YDPNIDQWSMLGDMQTAR PA
1
455-483 (29) EGAGLVVASGVIYCLGGYDGLNILNSVEK PA
1
484-500 (17) YDPHTGHWTNVTPMATK PA
1
502-534 (33) SGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIR PA
1
535-548 (14) TDSWTTVTSMTTPR PA
1
549-557 (9) CYVGATVLR PA
1
560-595 (36) LYAIAGYDGNSLLSSIECYDPIIDSWEVVTSMGTQR PA
1
596-604 (9) CDAGVCVLR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center