Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q53HC0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-32 (32) MTSPHFSSYDEGPLDVSMAATNLENQLHSAQK PA
0
55-69 (15) LQQHCTDLTYELTVK PA
1
70-80 (11) SSEQTGDGTSK PA
1
88-96 (9) CEELEAQLK PA
1
99-107 (9) ENENAELLK PA
1
113-124 (12) NAMITVLENTIK PA
1
141-151 (11) LTLLSSELEQR PA
1
152-166 (15) ASTIAYLTSQLHAAK PA
1
169-195 (27) LMSSSGTSDASPSGSPVLASYKPAPPK PA
1
209-223 (15) SLSAPLHPEFEEVYR PA
1
235-250 (16) EPVDAMPDPTPFLLAR PA
1
251-259 (9) ESAEVHLIK PA
1
260-272 (13) ERPLVIPPIASDR PA
1
273-281 (9) SGEQHSPAR PA
1
287-294 (8) AHVGVAHR PA
1
295-308 (14) IHHATPPQAQPEVK PA
1
309-319 (11) TLAVDQVNGGK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center