Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q59EK9-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MEASFVQTTMALGLSSK PA
3
46-72 (27) YTAEPIDDSSEEFVNFAAILEQILSHR PA
3
75-86 (12) GPVSWFSSDGQR PA
0
99-117 (19) VPNNCVSSIENMENISTAR PA
3
133-142 (10) MSEYITTALR PA
3
150-159 (10) FYDSGAIMLR PA
3
160-182 (23) DEATILTGMLIGLSAIDFSFCLK PA
3
190-201 (12) TPVVIDYTPYLK PA
3
202-215 (14) FTQSYDYLTDEEER PA
3
216-245 (30) HSAESSTSEDNSPEHPYLPLVTDEDSWYSK PA
3
261-268 (8) GYLEELVR PA
3
284-297 (14) LQLQLEEAAAQNQR PA
3
301-329 (29) ELEGVILELQEQLTGLIPSDHAPLAQGSK PA
3
330-355 (26) ELTTPLVNQWPSLGTLNGAEGASNSK PA
3
360-380 (21) HSFMSTEPLSAEASLSSDSQR PA
2
387-400 (14) DEEPWGPIGSSEPN PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center