Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q59EK9-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MEASFVQTTMALGLSSK PA
3
46-72 (27) YTAEPIDDSSEEFVNFAAILEQILSHR PA
3
75-91 (17) ACAPAGPVSWFSSDGQR PA
2
104-122 (19) VPNNCVSSIENMENISTAR PA
3
138-147 (10) MSEYITTALR PA
3
155-164 (10) FYDSGAIMLR PA
3
165-187 (23) DEATILTGMLIGLSAIDFSFCLK PA
3
195-206 (12) TPVVIDYTPYLK PA
3
207-220 (14) FTQSYDYLTDEEER PA
3
221-250 (30) HSAESSTSEDNSPEHPYLPLVTDEDSWYSK PA
3
266-273 (8) GYLEELVR PA
3
289-302 (14) LQLQLEEAAAQNQR PA
3
306-334 (29) ELEGVILELQEQLTGLIPSDHAPLAQGSK PA
3
335-360 (26) ELTTPLVNQWPSLGTLNGAEGASNSK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center