Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q5ST30-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MPHLPLASFRPPFWGLR PA
0
25-41 (17) FHSVSTQSEPHGSPISR PA
1
55-67 (13) QATLEAEIAGESK PA
1
80-93 (14) ELVLYEIPTKPGEK PA
1
95-107 (13) DVSGPLPPAYSPR PA
1
108-119 (12) YVEAAWYPWWVR PA
1
120-130 (11) EGFFKPEYQAR PA
1
131-168 (38) LPQATGETFSMCIPPPNVTGSLHIGHALTVAIQDALVR PA
1
174-196 (23) GDQVLWVPGSDHAGIATQAVVEK PA
2
226-234 (9) GGEICEQLR PA
2
235-244 (10) ALGASLDWDR PA
2
245-263 (19) ECFTMDVGSSVAVTEAFVR PA
2
273-284 (12) NHQLVNWSCALR PA
2
285-304 (20) SAISDIEVENRPLPGHTQLR PA
2
305-356 (52) LPGCPTPVSFGLLFSVAFPVDGEPDAEVVVGTTRPETLPGDVAVAVHPDDSR PA
2
367-392 (26) HPLMGQPLPLITDYAVQPHVGTGAVK PA
2
393-407 (15) VTPAHSPADAEMGAR PA
2
408-435 (28) HGLSPLNVIAEDGTMTSLCGDWLQGLHR PA
2
442-453 (12) IMSVLSEWGLFR PA
2
454-467 (14) GLQNHPMVLPICSR PA
2
468-477 (10) SGDVIEYLLK PA
2
494-509 (16) AVESGALELSPSFHQK PA
2
510-525 (16) NWQHWFSHIGDWCVSR PA
2
526-554 (29) QLWWGHQIPAYLVVEDHAQGEEDCWVVGR PA
2
561-578 (18) EVAAELTGRPGAELTLER PA
2
579-608 (30) DPDVLDTWFSSALFPFSALGWPQETPDLAR PA
2
609-628 (20) FYPLSLLETGSDLLLFWVGR PA
2
629-644 (16) MVMLGTQLTGQLPFSK PA
2
645-652 (8) VLLHPMVR PA
2
662-670 (9) SLGNVLDPR PA
3
671-684 (14) DIISGVEMQVLQEK PA
3
687-703 (17) SGNLDPAELAIVAAAQK PA
3
705-719 (15) DFPHGIPECGTDALR PA
3
720-743 (24) FTLCSHGVQAGDLHLSVSEVQSCR PA
3
755-763 (9) FILNALGEK PA
3
764-785 (22) FVPQPAEELSPSSPMDAWILSR PA
3
786-795 (10) LALAAQECER PA
3
801-851 (51) ELSLVTHALHHFWLHNLCDVYLEAVKPVLWHSPRPLGPPQVLFSCADLGLR PA
3
852-867 (16) LLAPLMPFLAEELWQR PA
3
868-895 (28) LPPRPGCPPAPSISVAPYPSACSLEHWR PA
3
906-914 (9) VQEVVQVLR PA
3
929-1002 (74) VLLQSSEPGDQGLFEAFLEPLGTLGYCGAVGLLPPGAAAPSGWAQAPLSDTAQVYMELQGLVDPQIQLPLLAAR PA
3
1009-1016 (8) QLDSLTAR PA
3
1017-1027 (11) TPSEGEAGTQR PA
3
1031-1040 (10) LSSLQLELSK PA
3
1050-1063 (14) QLMDEPPAPGSPEL PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center