Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q5ST30-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MVFFCPVPLFCPGLAPR PA
0
18-53 (36) DPRPCSFLPPVTFGNGQRPSAVLGGPHGHVGDPAHR PA
0
54-67 (14) AAALQQVWRPEIPR PA
0
68-90 (23) HLQGNPPLLTPPCPQVLLHPMVR PA
0
100-108 (9) SLGNVLDPR PA
3
109-122 (14) DIISGVEMQVLQEK PA
3
125-141 (17) SGNLDPAELAIVAAAQK PA
3
143-157 (15) DFPHGIPECGTDALR PA
3
158-181 (24) FTLCSHGVQAGDLHLSVSEVQSCR PA
3
193-201 (9) FILNALGEK PA
3
202-223 (22) FVPQPAEELSPSSPMDAWILSR PA
3
224-233 (10) LALAAQECER PA
3
239-289 (51) ELSLVTHALHHFWLHNLCDVYLEAVKPVLWHSPRPLGPPQVLFSCADLGLR PA
3
290-305 (16) LLAPLMPFLAEELWQR PA
3
306-333 (28) LPPRPGCPPAPSISVAPYPSACSLEHWR PA
3
344-352 (9) VQEVVQVLR PA
3
367-440 (74) VLLQSSEPGDQGLFEAFLEPLGTLGYCGAVGLLPPGAAAPSGWAQAPLSDTAQVYMELQGLVDPQIQLPLLAAR PA
3
447-454 (8) QLDSLTAR PA
3
455-465 (11) TPSEGEAGTQR PA
3
469-478 (10) LSSLQLELSK PA
3
488-501 (14) QLMDEPPAPGSPEL PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center