Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q5ST30-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-28 (28) MCIPPPNVTGSLHIGHALTVAIQDALVR PA
0
34-56 (23) GDQVLWVPGSDHAGIATQAVVEK PA
2
86-94 (9) GGEICEQLR PA
2
95-104 (10) ALGASLDWDR PA
2
105-123 (19) ECFTMDVGSSVAVTEAFVR PA
2
133-144 (12) NHQLVNWSCALR PA
2
145-164 (20) SAISDIEVENRPLPGHTQLR PA
2
165-216 (52) LPGCPTPVSFGLLFSVAFPVDGEPDAEVVVGTTRPETLPGDVAVAVHPDDSR PA
2
227-252 (26) HPLMGQPLPLITDYAVQPHVGTGAVK PA
2
253-267 (15) VTPAHSPADAEMGAR PA
2
268-295 (28) HGLSPLNVIAEDGTMTSLCGDWLQGLHR PA
2
302-313 (12) IMSVLSEWGLFR PA
2
314-327 (14) GLQNHPMVLPICSR PA
2
328-337 (10) SGDVIEYLLK PA
2
354-369 (16) AVESGALELSPSFHQK PA
2
370-385 (16) NWQHWFSHIGDWCVSR PA
2
386-414 (29) QLWWGHQIPAYLVVEDHAQGEEDCWVVGR PA
2
421-438 (18) EVAAELTGRPGAELTLER PA
2
439-468 (30) DPDVLDTWFSSALFPFSALGWPQETPDLAR PA
2
469-488 (20) FYPLSLLETGSDLLLFWVGR PA
2
489-504 (16) MVMLGTQLTGQLPFSK PA
2
505-512 (8) VLLHPMVR PA
2
522-530 (9) SLGNVLDPR PA
3
531-544 (14) DIISGVEMQVLQEK PA
3
547-563 (17) SGNLDPAELAIVAAAQK PA
3
565-579 (15) DFPHGIPECGTDALR PA
3
580-603 (24) FTLCSHGVQAGDLHLSVSEVQSCR PA
3
615-623 (9) FILNALGEK PA
3
624-645 (22) FVPQPAEELSPSSPMDAWILSR PA
3
646-655 (10) LALAAQECER PA
3
661-711 (51) ELSLVTHALHHFWLHNLCDVYLEAVKPVLWHSPRPLGPPQVLFSCADLGLR PA
3
712-727 (16) LLAPLMPFLAEELWQR PA
3
728-755 (28) LPPRPGCPPAPSISVAPYPSACSLEHWR PA
3
766-774 (9) VQEVVQVLR PA
3
789-862 (74) VLLQSSEPGDQGLFEAFLEPLGTLGYCGAVGLLPPGAAAPSGWAQAPLSDTAQVYMELQGLVDPQIQLPLLAAR PA
3
869-876 (8) QLDSLTAR PA
3
877-887 (11) TPSEGEAGTQR PA
3
891-900 (10) LSSLQLELSK PA
3
910-923 (14) QLMDEPPAPGSPEL PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center