Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q5ST30-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-47 (38) AVGTAGGPCAEQISAPFQTLLMPHLPLASFRPPFWGLR PA
0
55-71 (17) FHSVSTQSEPHGSPISR PA
1
85-97 (13) QATLEAEIAGESK PA
1
110-123 (14) ELVLYEIPTKPGEK PA
1
125-137 (13) DVSGPLPPAYSPR PA
1
138-149 (12) YVEAAWYPWWVR PA
1
150-160 (11) EGFFKPEYQAR PA
1
161-198 (38) LPQATGETFSMCIPPPNVTGSLHIGHALTVAIQDALVR PA
1
204-226 (23) GDQVLWVPGSDHAGIATQAVVEK PA
2
256-264 (9) GGEICEQLR PA
2
265-274 (10) ALGASLDWDR PA
2
275-293 (19) ECFTMDVGSSVAVTEAFVR PA
2
303-314 (12) NHQLVNWSCALR PA
2
315-334 (20) SAISDIEVENRPLPGHTQLR PA
2
335-386 (52) LPGCPTPVSFGLLFSVAFPVDGEPDAEVVVGTTRPETLPGDVAVAVHPDDSR PA
2
397-422 (26) HPLMGQPLPLITDYAVQPHVGTGAVK PA
2
423-437 (15) VTPAHSPADAEMGAR PA
2
438-465 (28) HGLSPLNVIAEDGTMTSLCGDWLQGLHR PA
2
472-483 (12) IMSVLSEWGLFR PA
2
484-497 (14) GLQNHPMVLPICSR PA
2
498-507 (10) SGDVIEYLLK PA
2
524-539 (16) AVESGALELSPSFHQK PA
2
540-555 (16) NWQHWFSHIGDWCVSR PA
2
556-584 (29) QLWWGHQIPAYLVVEDHAQGEEDCWVVGR PA
2
591-608 (18) EVAAELTGRPGAELTLER PA
2
609-638 (30) DPDVLDTWFSSALFPFSALGWPQETPDLAR PA
2
639-658 (20) FYPLSLLETGSDLLLFWVGR PA
2
659-674 (16) MVMLGTQLTGQLPFSK PA
2
675-682 (8) VLLHPMVR PA
2
692-700 (9) SLGNVLDPR PA
3
701-714 (14) DIISGVEMQVLQEK PA
3
717-733 (17) SGNLDPAELAIVAAAQK PA
3
735-749 (15) DFPHGIPECGTDALR PA
3
750-773 (24) FTLCSHGVQAGDLHLSVSEVQSCR PA
3
785-793 (9) FILNALGEK PA
3
794-815 (22) FVPQPAEELSPSSPMDAWILSR PA
3
816-825 (10) LALAAQECER PA
3
831-881 (51) ELSLVTHALHHFWLHNLCDVYLEAVKPVLWHSPRPLGPPQVLFSCADLGLR PA
3
882-897 (16) LLAPLMPFLAEELWQR PA
3
898-925 (28) LPPRPGCPPAPSISVAPYPSACSLEHWR PA
3
936-944 (9) VQEVVQVLR PA
3
959-1032 (74) VLLQSSEPGDQGLFEAFLEPLGTLGYCGAVGLLPPGAAAPSGWAQAPLSDTAQVYMELQGLVDPQIQLPLLAAR PA
3
1039-1046 (8) QLDSLTAR PA
3
1047-1057 (11) TPSEGEAGTQR PA
3
1061-1070 (10) LSSLQLELSK PA
3
1080-1093 (14) QLMDEPPAPGSPEL PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center