Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q5T7B8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-28 (28) MASWLYECLCEAELAQYYSHFTALGLQK PA
3
43-51 (9) LGVHDMNDR PA
3
77-84 (8) HLQTSSLR PA
3
97-107 (11) QLNFDSPADNK PA
3
110-130 (21) NASNDGFEMCSLSDFSANEQK PA
3
136-150 (15) VLEHMLPDDSQYHTK PA
3
151-191 (41) TGILNATAGDSYVQTEISTSLFSPNYLSAILGDCDIPIIQR PA
3
192-208 (17) ISHVSGYNYGIPHSCIR PA
3
215-223 (9) QNPWTEMEK PA
2
241-251 (11) GEINIITVEDK PA
2
252-259 (8) ETLLVHEK PA
2
261-292 (32) EAVDLTQYILQHVFYFDEVFGEACTNQDVYMK PA
1
293-319 (27) TTHPLIQHIFNGGNATCFAYGQTGAGK PA
1
320-338 (19) TYTMIGTHENPGLYALAAK PA
1
343-350 (8) QLEVSQPR PA
1
352-373 (22) HLFVWISFYEIYCGQLYDLLNR PA
1
385-409 (25) HMVQIVGLQELQVDSVELLLEVILK PA
1
415-427 (13) STGATGVNADSSR PA
2
428-437 (10) SHAVIQIQIK PA
2
447-457 (11) ISFIDLAGSER PA
2
470-483 (14) MEGAEINQSLLALK PA
2
488-499 (12) ALDQEHTHTPFR PA
2
509-516 (8) DSFIGNAK PA
2
517-538 (22) TCMIANISPSHVATEHTLNTLR PA
2
552-559 (8) CCTSVTSR PA
2
562-569 (8) TSGNSSPK PA
2
571-582 (12) IQSSPGALSEDK PA
2
590-605 (16) LGFQQSLTVAAPGSTR PA
2
608-625 (18) VHPLTSHPPNIPFTSAPK PA
2
635-649 (15) GSPSQEWVIHASPVK PA
2
661-672 (12) KPEESAPLCSEK PA
2
679-686 (8) TVLGWESR PA
2
687-696 (10) ASGPGEGLVR PA
2
706-714 (9) VQTVQPVQK PA
2
720-730 (11) VELSFGNAHHR PA
2
731-739 (9) AEYSQDSQR PA
2
740-758 (19) GTPARPASEAWTNIPPHQK PA
2
766-780 (15) FYHQQFQQPPLLQQK PA
2
792-840 (49) QYRPPEGQLTNETPPLFHSYSENHDGAQVEELDDSDFSEDSFSHISSQR PA
2
846-867 (22) NTLENSEDSFFLHQTWGQGPEK PA
2
873-881 (9) QQSLFSSPR PA
2
904-914 (11) AALDHSCSPSK PA
2
922-932 (11) ENSTSSGPSPR PA
2
933-949 (17) DSLAEKPYCSQVDFIYR PA
2
953-961 (9) GGGSSFDLR PA
2
963-1001 (39) DASQSEVSGENEGNLPSPEEDGFTISLSHVAVPGSPDQR PA
2
1002-1009 (8) DTVTTPLR PA
2
1010-1024 (15) EVSADGPIQVTSTVK PA
2
1025-1035 (11) NGHAVPGEDPR PA
2
1036-1110 (75) GQLGTHAEYASGLMSPLTMSLLENPDNEGSPPSEQLVQDGATHSLVAESTGGPVVSHTVPSGDQEAALPVSSATR PA
2
1111-1136 (26) HLWLSSSPPDNKPGGDLPALSPSPIR PA
1
1147-1157 (11) EADLGEACQSR PA
1
1158-1209 (52) ETVLFSHEHMGSEQYDADAEETGLDGSWGFPGKPFTTIHMGVPHSGPTLTPR PA
1
1210-1224 (15) TGSSDVADQLWAQER PA
1
1230-1243 (14) LGWQEFGLSTDPIK PA
1
1244-1261 (18) LPCNSENVTWLKPRPISR PA
1
1262-1277 (16) CLARPSSPLVPSCSPK PA
1
1284-1296 (13) QPTLEQAQQVVIR PA
1
1297-1311 (15) AHQEQLDEMAELGFK PA
1
1312-1338 (27) EETLMSQLASNDFEDFVTQLDEIMVLK PA
1
1347-1368 (22) SQLQLYLTCHGPTAAPEGTVPS PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center