Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q5T7B8-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-28 (28) MASWLYECLCEAELAQYYSHFTALGLQK PA
3
43-51 (9) LGVHDMNDR PA
3
77-84 (8) HLQTSSLR PA
3
97-107 (11) QLNFDSPADNK PA
3
110-130 (21) NASNDGFEMCSLSDFSANEQK PA
3
136-150 (15) VLEHMLPDDSQYHTK PA
3
151-191 (41) TGILNATAGDSYVQTEISTSLFSPNYLSAILGDCDIPIIQR PA
3
192-208 (17) ISHVSGYNYGIPHSCIR PA
3
215-223 (9) QNPWTEMEK PA
2
241-251 (11) GEINIITVEDK PA
2
252-259 (8) ETLLVHEK PA
2
261-275 (15) EAVDLTQYILQVILK PA
0
281-293 (13) STGATGVNADSSR PA
2
294-303 (10) SHAVIQIQIK PA
2
313-323 (11) ISFIDLAGSER PA
2
336-349 (14) MEGAEINQSLLALK PA
2
354-365 (12) ALDQEHTHTPFR PA
2
375-382 (8) DSFIGNAK PA
2
383-404 (22) TCMIANISPSHVATEHTLNTLR PA
2
418-425 (8) CCTSVTSR PA
2
428-435 (8) TSGNSSPK PA
2
437-448 (12) IQSSPGALSEDK PA
2
456-471 (16) LGFQQSLTVAAPGSTR PA
2
474-491 (18) VHPLTSHPPNIPFTSAPK PA
2
501-515 (15) GSPSQEWVIHASPVK PA
2
527-538 (12) KPEESAPLCSEK PA
2
545-552 (8) TVLGWESR PA
2
553-562 (10) ASGPGEGLVR PA
2
572-580 (9) VQTVQPVQK PA
2
586-596 (11) VELSFGNAHHR PA
2
597-605 (9) AEYSQDSQR PA
2
606-624 (19) GTPARPASEAWTNIPPHQK PA
2
632-646 (15) FYHQQFQQPPLLQQK PA
2
658-706 (49) QYRPPEGQLTNETPPLFHSYSENHDGAQVEELDDSDFSEDSFSHISSQR PA
2
712-733 (22) NTLENSEDSFFLHQTWGQGPEK PA
2
739-747 (9) QQSLFSSPR PA
2
770-780 (11) AALDHSCSPSK PA
2
788-798 (11) ENSTSSGPSPR PA
2
799-815 (17) DSLAEKPYCSQVDFIYR PA
2
819-827 (9) GGGSSFDLR PA
2
829-867 (39) DASQSEVSGENEGNLPSPEEDGFTISLSHVAVPGSPDQR PA
2
868-875 (8) DTVTTPLR PA
2
876-890 (15) EVSADGPIQVTSTVK PA
2
891-901 (11) NGHAVPGEDPR PA
2
902-976 (75) GQLGTHAEYASGLMSPLTMSLLENPDNEGSPPSEQLVQDGATHSLVAESTGGPVVSHTVPSGDQEAALPVSSATR PA
2
977-1002 (26) HLWLSSSPPDNKPGGDLPALSPSPIR PA
1
1013-1023 (11) EADLGEACQSR PA
1
1024-1075 (52) ETVLFSHEHMGSEQYDADAEETGLDGSWGFPGKPFTTIHMGVPHSGPTLTPR PA
1
1076-1090 (15) TGSSDVADQLWAQER PA
1
1096-1109 (14) LGWQEFGLSTDPIK PA
1
1110-1127 (18) LPCNSENVTWLKPRPISR PA
1
1128-1143 (16) CLARPSSPLVPSCSPK PA
1
1150-1162 (13) QPTLEQAQQVVIR PA
1
1163-1177 (15) AHQEQLDEMAELGFK PA
1
1178-1204 (27) EETLMSQLASNDFEDFVTQLDEIMVLK PA
1
1213-1234 (22) SQLQLYLTCHGPTAAPEGTVPS PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center