Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q5T7B8-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-28 (28) MASWLYECLCEAELAQYYSHFTALGLQK PA
3
43-51 (9) LGVHDMNDR PA
3
77-84 (8) HLQTSSLR PA
3
97-107 (11) QLNFDSPADNK PA
3
110-130 (21) NASNDGFEMCSLSDFSANEQK PA
3
136-150 (15) VLEHMLPDDSQYHTK PA
3
151-191 (41) TGILNATAGDSYVQTEISTSLFSPNYLSAILGDCDIPIIQR PA
3
192-208 (17) ISHVSGYNYGIPHSCIR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center