Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q5T7P8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MSGVWGAGGPR PA
0
12-24 (13) CQEALAVLASLCR PA
0
25-38 (14) ARPPPLGLDVETCR PA
0
39-47 (9) SFELQPPER PA
0
48-82 (35) SPSAAGAGTSVSLLAVVVIVCGVALVAVFLFLFWK PA
0
92-112 (21) EASSPSSANPPLEALQSPSFR PA
1
121-133 (13) DPSTLGFLEAAVK PA
1
134-150 (17) ISHTSPDIPAEVQMSVK PA
1
162-171 (10) QTTEPASSTR PA
1
182-206 (25) QMHVSSVDYGNELPPAAEQPTSIGR PA
1
216-223 (8) SVDGEDAK PA
1
239-249 (11) YDYETETLIVR PA
1
260-270 (11) DFCGSSDPYVK PA
1
289-310 (22) TLNPTFDENFHFPVPYEELADR PA
1
312-321 (10) LHLSVFDFDR PA
1
325-344 (20) HDMIGEVILDNLFEASDLSR PA
1
351-377 (27) DIQYATSESVDLGEIMFSLCYLPTAGR PA
1
390-402 (13) AMDITGYSDPYVK PA
1
403-410 (8) VSLLCDGR PA
1
422-455 (34) NTLNPVYNEAIIFDIPPENMDQVSLLISVMDYDR PA
1
456-466 (11) VGHNEIIGVCR PA
1
467-476 (10) VGITAEGLGR PA
1
477-487 (11) DHWNEMLAYPR PA
1
488-500 (13) KPIAHWHSLVEVK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center