Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q5T7P8-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-27 (21) EASSPSSANPPLEALQSPSFR PA
1
36-48 (13) DPSTLGFLEAAVK PA
1
49-65 (17) ISHTSPDIPAEVQMSVK PA
1
77-86 (10) QTTEPASSTR PA
1
97-121 (25) QMHVSSVDYGNELPPAAEQPTSIGR PA
1
131-138 (8) SVDGEDAK PA
1
154-164 (11) YDYETETLIVR PA
1
175-185 (11) DFCGSSDPYVK PA
1
204-225 (22) TLNPTFDENFHFPVPYEELADR PA
1
227-236 (10) LHLSVFDFDR PA
1
240-259 (20) HDMIGEVILDNLFEASDLSR PA
1
266-292 (27) DIQYATSESVDLGEIMFSLCYLPTAGR PA
1
305-317 (13) AMDITGYSDPYVK PA
1
318-325 (8) VSLLCDGR PA
1
337-370 (34) NTLNPVYNEAIIFDIPPENMDQVSLLISVMDYDR PA
1
371-381 (11) VGHNEIIGVCR PA
1
382-391 (10) VGITAEGLGR PA
1
392-402 (11) DHWNEMLAYPR PA
1
403-415 (13) KPIAHWHSLVEVK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center