Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q5TG30-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
12-42 (31) LHPAGSAGCSTGVESSSMDGFWMEVEQIQQR PA
0
47-103 (57) EEDSGGNEGQLPEEGEAESQWLQDTGLSGLLGGLGLDGDHQELLSTLTQTQVAAVCR PA
0
125-134 (10) DVFGVFNSGK PA
0
135-145 (11) MSSENGDSGMK PA
0
146-155 (10) GAQLSSGASK PA
0
156-171 (16) FPPAAEPGGLQEQAGR PA
0
172-191 (20) EEAFNMDSAYSEQAAVLLQR PA
0
197-204 (8) GGTSAWGK PA
0
222-231 (10) IGDLSLQDMR PA
0
233-253 (21) VPSLALIELTALCDILGLDLK PA
0
267-281 (15) LFGVPLDSLLEADHK PA
0
282-301 (20) VLPSTQVPLVLQALLSCLEK PA
0
303-311 (9) GLDMEGILR PA
0
329-350 (22) DFYAGLFSWDEVHHNDASDLLK PA
0
356-379 (24) LPTPLLTAEYLPAFAVVPNIPNLK PA
0
382-397 (16) LQVLHLLILILPEPNR PA
0
423-441 (19) NVSTVMAPNLFLHQGRPPK PA
0
449-480 (32) QLAEGAAEVVQIMVHYQDLLWTVASFLVAQVR PA
0
489-498 (10) RPQLCDAGLK PA
0
511-520 (10) AGDGLEATPK PA
0
524-531 (8) IQVVWPIK PA
0
536-543 (8) VPLTPSTK PA
0
550-560 (11) QFTEHLSPGSK PA
0
561-576 (16) GQEDSEDMDSLLLHHR PA
0
577-596 (20) SMESANILLYEVGGNINEHR PA
0
597-608 (12) LDPDAYLLDLYR PA
0
609-618 (10) ANPHGEWVLK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center