Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q5U4N7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MIQSSQPMSLK PA
0
48-59 (12) YSYTVLSSWPER PA
0
70-77 (8) FLVRPNTR PA
0
110-117 (8) HSWAEFLK PA
0
121-139 (19) SFQMSNTSQPDPSRPGTER PA
0
144-177 (34) EAGCRPLGQLDSFSWAARPPPGAAGLAVSEGFFR PA
0
181-191 (11) SSAPSSPSFSR PA
0
192-207 (16) ALMSNTYLCFLTTGPR PA
0
216-223 (8) SFPATSPR PA
0
234-241 (8) APALSPSR PA
0
242-250 (9) ELSFTSAPF PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center