Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q5VWX1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-14 (9) YLPELMAEK PA
5
15-26 (12) DSLDPSFVHASR PA
0
27-34 (8) LLAEEIEK PA
0
49-56 (8) YLDVISNK PA
0
91-98 (8) LQEETGAK PA
2
124-147 (24) YAHLSDELHVLIEVFAPPGEAYSR PA
0
148-156 (9) MSHALEEIK PA
0
158-168 (11) FLVPDYNDEIR PA
0
174-186 (13) ELSYLNGSEDSGR PA
0
197-204 (8) IAPTAPSR PA
0
207-218 (12) GGAIPPPPPPGR PA
0
231-240 (10) GALPVPPVAR PA
0
249-257 (9) GAPTVPGYR PA
0
258-326 (69) APPPPAHEAYEEYGYDDGYGGEYDDQTYETYDNSYATQTQSVPEYYDYGHGVSEDAYDSYAPEEWATTR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center