Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q5W0B1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-24 (24) MAQTVQNVTLSLTLPITCHICLGK PA
0
27-47 (21) QPVICINNHVFCSICIDLWLK PA
0
48-56 (9) NNSQCPACR PA
0
57-66 (10) VPITPENPCK PA
0
67-84 (18) EIIGGTSESEPMLSHTVR PA
0
98-108 (11) EYEDEIDCLQK PA
0
117-125 (9) NLSLESQIK PA
0
126-142 (17) TILDPLTLVQGNQNEDK PA
0
143-151 (9) HLVTDNPSK PA
0
152-161 (10) INPETVAEWK PA
0
166-173 (8) TANEIYEK PA
0
190-197 (8) LENGGLVR PA
0
217-225 (9) FAVAALQSK PA
0
246-258 (13) YIEELESQVAQLK PA
0
265-280 (16) EAMNSICQTALSADGK PA
0
284-292 (9) GSEEDVVSK PA
0
301-319 (19) QPGSSTSSSSHLAKPSSSR PA
0
320-327 (8) LCDTSSAR PA
0
343-366 (24) DLYQEQVEVMLDVTDTSMDTYLER PA
0
367-379 (13) EWGNKPSDCVPYK PA
0
380-406 (27) DEELYDLPAPCTPLSLSCLQLSTPENR PA
0
407-417 (11) ESSVVQAGGSK PA
0
426-440 (15) LVFDDFCDSSNVSNK PA
0
441-449 (9) DSSEDDISR PA
0
456-463 (8) SECFSSPK PA
0
464-498 (35) TGFWDCCSTSYAQNLDFESSEGNTIANSVGEISSK PA
0
524-537 (14) TSSEASMDAAYLDK PA
0
538-552 (15) ISELDSMMSESDNSK PA
0
553-560 (8) SPCNNGFK PA
0
561-569 (9) SLDLDGLSK PA
0
570-582 (13) SSQGSEFLEEPDK PA
0
594-661 (68) GSLTNDQLENGSEWKPTSFFLLSPSDQEMNEDFSLHSSSCPVTNEIKPPSCLFQTEFSQGILLSSSHR PA
0
675-698 (24) MSSEMHSLHNHLQSPWSTSFVPEK PA
0
711-722 (12) IQSSLSSASPSK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center