Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q68CL5-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-19 (19) MEEEASSPGLGCSKPHLEK PA
4
27-47 (21) ILESSPGVTEVTIIEKPPAER PA
4
48-56 (9) HMISSWEQK PA
4
57-66 (10) NNCVMPEDVK PA
4
67-82 (16) NFYLMTNGFHMTWSVK PA
4
83-100 (18) LDEHIIPLGSMAINSISK PA
2
101-141 (41) LTQLTQSSMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSR PA
2
142-155 (14) SVIFELDSCNGSGK PA
4
162-178 (17) SGKPALAEDTEIWFLDR PA
4
179-194 (16) ALYWHFLTDTFTAYYR PA
4
195-219 (25) LLITHLGLPQWQYAFTSYGISPQAK PA
4
236-246 (11) LAVEPLQWELR PA
0
247-258 (12) SCVSAGMGTGHK PA
0
276-293 (18) QSNSMGTTVSQSFLSYGK PA
0
294-301 (8) NVLFFTVR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center