Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q68DL7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-19 (14) QQSLFFITLPDLNK PA
0
46-76 (31) QLLFLHQDILTSPVSGILNQIWVVMAIPFYK PA
0
97-113 (17) VIPVILQNCLSYSFMAR PA
0
121-129 (9) TGHLLIQGR PA
0
130-137 (8) DFLSQMGK PA
0
138-162 (25) QSAVVLNINVTETQVCLSIEACTIR PA
0
170-179 (10) EFEISQSIIK PA
0
192-206 (15) HSILSNWCYVLPSMK PA
0
207-231 (25) MGQIINIFHAIPAACPFHSYGDFQR PA
0
232-240 (9) HWDALYGYK PA
0
250-257 (8) IYCNIYFK PA
0
263-272 (10) TFTYPLSCIR PA
0
273-281 (9) SQPMQFFPR PA
0
282-289 (8) VDSEVVLK PA
0
299-308 (10) LPHICGFPIK PA
0
309-329 (21) MTSKPCYYTQELTKPNIQEHK PA
0
330-338 (9) VKPPNLTTK PA
0
343-351 (9) ASLTQATSR PA
0
352-369 (18) KPACAQSLLPCSVAVDHK PA
0
370-395 (26) VELSVSQPTSGIFSALHLQPESVQGR PA
0
403-415 (13) APQVHSEVLMPNR PA
0
416-434 (19) GNTQVQHTNLSSQSNITPK PA
0
449-457 (9) NTSVLGSPK PA
0
460-467 (8) QHDVTQSK PA
0
473-480 (8) TSMIQHDK PA
0
481-488 (8) LNLGPAIK PA
0
491-514 (24) YSSNIQMQAANNLNQENSRPLQEK PA
0
515-524 (10) NTESSENMTK PA
0
541-559 (19) QLSNSAVFVVSNNNLGVVK PA
0
560-567 (8) SAVDFQMK PA
0
576-583 (8) GITQILGK PA
0
593-607 (15) QPHIFESDGETEDPR PA
0
608-618 (11) LLQQQSENQAK PA
0
619-626 (8) EVGTSDHR PA
0
651-665 (15) HHSDTVHYGQSSSSK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center