Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6H9L7-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-30 (23) AGLLLCVLLLAALLEAALGLPVK PA
4
36-44 (9) GPRPGSLTR PA
4
45-58 (14) LAEVSASPDPRPLK PA
2
59-68 (10) EEEEAPLLPR PA
2
69-98 (30) THLQAEPHQHGCWTVTEPAAMTPGNATPPR PA
2
99-106 (8) TPEVTPLR PA
2
112-139 (28) LPGLANTTLSTPNPDTQASASPDPRPLR PA
1
150-179 (30) THLQAELHQHGCWTVTEPAALTPGNATPPR PA
2
180-192 (13) TQEVTPLLLELQK PA
2
193-214 (22) LPELVHATLSTPNPDNQTMSLR PA
0
216-233 (18) SGVPGLPAVGTAALASSR PA
0
234-259 (26) GLGPVAMAALPPRPVPVTCPPVLALR PA
0
262-269 (8) TPWASPVR PA
0
270-279 (10) SGSSWPAMLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center