Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6H9L7-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-30 (23) AGLLLCVLLLAALLEAALGLPVK PA
4
36-44 (9) GPRPGSLTR PA
4
45-58 (14) LAEASASPDPRPLR PA
0
69-98 (30) THLQAELHQHGCWTVTEPAALTPGNATPPR PA
2
99-111 (13) TQEVTPLLLELQK PA
2
112-132 (21) LPELVHATLSTPNPDNQVTIK PA
1
133-173 (41) VVEDPQAEVSIDLLAEPSNPPPQDTLSWLPALWSFLWGDYK PA
2
189-207 (19) EEDEDYPSEDIEGEDQEDK PA
2
208-238 (31) EEDEEEQALWFNGTTDNWDQGWLAPGDWVFK PA
2
239-249 (11) DSVSYDYEPQK PA
2
250-265 (16) EWSPWSPCSGNCSTGK PA
2
269-282 (14) TRPCGYGCTATETR PA
2
283-295 (13) TCDLPSCPGTEDK PA
2
296-306 (11) DTLGLPSEEWK PA
2
311-325 (15) NATDMHDQDVDSCEK PA
2
344-370 (27) DLPSCPCAYPLEAMDSPVSLQDEHQGR PA
2
384-392 (9) LDIYQPTAR PA
2
397-418 (22) SMLSGESSTLAAQHCCYDEDSR PA
2
425-439 (15) GAGMPNLISTDFSPK PA
2
444-453 (10) FDTTPWILCK PA
2
459-469 (11) LHAVLPPNNGR PA
2
470-488 (19) ACTDNPLEEEYLAQLQEAK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center