Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6IA86-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MVAPVLETSHVFCCPNR PA
6
20-29 (10) GVLNWSSGPR PA
6
30-47 (18) GLLAFGTSCSVVLYDPLK PA
6
49-60 (12) VVVTNLNGHTAR PA
6
61-69 (9) VNCIQWICK PA
6
70-99 (30) QDGSPSTELVSGGSDNQVIHWEIEDNQLLK PA
6
100-119 (20) AVHLQGHEGPVYAVHAVYQR PA
6
121-140 (20) TSDPALCTLIVSAAADSAVR PA
6
146-160 (15) GPEVPILACGNDDCR PA
1
161-173 (13) IHIFAQQNDQFQK PA
5
174-185 (12) VLSLCGHEDWIR PA
5
186-194 (9) GVEWAAFGR PA
5
195-208 (14) DLFLASCSQDCLIR PA
6
216-228 (13) STSLETQDDDNIR PA
6
231-242 (12) ENTFTIENESVK PA
6
243-271 (29) IAFAVTLETVLAGHENWVNAVHWQPVFYK PA
6
272-280 (9) DGVLQQPVR PA
6
281-288 (8) LLSASMDK PA
6
289-307 (19) TMILWAPDEESGVWLEQVR PA
4
308-343 (36) VGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWK PA
4
351-387 (37) EWTPEIVISGHFDGVQDLVWDPEGEFIITVGTDQTTR PA
6
396-416 (21) DQSQVTWHEIARPQIHGYDLK PA
6
424-433 (10) FQFVSGADEK PA
6
443-481 (39) NFVENFCAITGQSLNHVLCNQDSDLPEGATVPALGLSNK PA
6
482-536 (55) AVFQGDIASQPSDEEELLTSTGFEYQQVAFQPSILTEPPTEDHLLQNTLWPEVQK PA
6
537-553 (17) LYGHGYEIFCVTCNSSK PA
6
554-561 (8) TLLASACK PA
6
566-579 (14) EHAAIILWNTTSWK PA
6
580-601 (22) QVQNLVFHSLTVTQMAFSPNEK PA
6
618-637 (20) QDTISPEFEPVFSLFAFTNK PA
5
645-656 (12) IIWSCDWSPDSK PA
5
667-711 (45) VVVWGECDSTDDCIEHNIGPCSSVLDVGGAVTAVSVCPVLHPSQR PA
5
712-722 (11) YVVAVGLECGK PA
5
731-757 (27) TDQVPEINDWTHCVETSQSQSHTLAIR PA
5
772-791 (20) EAEGAEWLHFASCGEDHTVK PA
5
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center