Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6IA86-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MVAPVLETSHVFCCPNR PA
6
20-29 (10) GVLNWSSGPR PA
6
30-47 (18) GLLAFGTSCSVVLYDPLK PA
6
49-60 (12) VVVTNLNGHTAR PA
6
61-69 (9) VNCIQWICK PA
6
70-99 (30) QDGSPSTELVSGGSDNQVIHWEIEDNQLLK PA
6
100-119 (20) AVHLQGHEGPVYAVHAVYQR PA
6
121-140 (20) TSDPALCTLIVSAAADSAVR PA
6
146-186 (41) GPEVMCLQTLNFGNGFALALCLSFLPNTDVPILACGNDDCR PA
1
187-199 (13) IHIFAQQNDQFQK PA
5
200-211 (12) VLSLCGHEDWIR PA
5
212-220 (9) GVEWAAFGR PA
5
221-234 (14) DLFLASCSQDCLIR PA
6
242-254 (13) STSLETQDDDNIR PA
6
257-268 (12) ENTFTIENESVK PA
6
269-297 (29) IAFAVTLETVLAGHENWVNAVHWQPVFYK PA
6
298-306 (9) DGVLQQPVR PA
6
307-314 (8) LLSASMDK PA
6
315-333 (19) TMILWAPDEESGVWLEQVR PA
4
334-369 (36) VGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWK PA
4
377-413 (37) EWTPEIVISGHFDGVQDLVWDPEGEFIITVGTDQTTR PA
6
422-442 (21) DQSQVTWHEIARPQIHGYDLK PA
6
450-459 (10) FQFVSGADEK PA
6
469-507 (39) NFVENFCAITGQSLNHVLCNQDSDLPEGATVPALGLSNK PA
6
508-562 (55) AVFQGDIASQPSDEEELLTSTGFEYQQVAFQPSILTEPPTEDHLLQNTLWPEVQK PA
6
563-579 (17) LYGHGYEIFCVTCNSSK PA
6
580-587 (8) TLLASACK PA
6
592-605 (14) EHAAIILWNTTSWK PA
6
606-627 (22) QVQNLVFHSLTVTQMAFSPNEK PA
6
644-674 (31) QDTISPEFVELFGLVIGVLTASISSLGVETK PA
0
676-705 (30) WLSGVSATPLMTVLSTTLAPAPQSWTWVGL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center