Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6IA86-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MVAPVLETSHVFCCPNR PA
6
20-29 (10) GVLNWSSGPR PA
6
30-47 (18) GLLAFGTSCSVVLYDPLK PA
6
49-60 (12) VVVTNLNGHTAR PA
6
61-69 (9) VNCIQWICK PA
6
70-99 (30) QDGSPSTELVSGGSDNQVIHWEIEDNQLLK PA
6
100-119 (20) AVHLQGHEGPVYAVHAVYQR PA
6
121-140 (20) TSDPALCTLIVSAAADSAVR PA
6
161-173 (13) AWKPPASLALCSR PA
1
174-188 (15) SCDSMVSCYASILCK PA
1
195-203 (9) LHTFWHHNR PA
1
204-225 (22) ISFLPSAFRPIPILACGNDDCR PA
1
226-238 (13) IHIFAQQNDQFQK PA
5
239-250 (12) VLSLCGHEDWIR PA
5
251-259 (9) GVEWAAFGR PA
5
260-273 (14) DLFLASCSQDCLIR PA
6
281-293 (13) STSLETQDDDNIR PA
6
296-307 (12) ENTFTIENESVK PA
6
308-336 (29) IAFAVTLETVLAGHENWVNAVHWQPVFYK PA
6
337-345 (9) DGVLQQPVR PA
6
346-353 (8) LLSASMDK PA
6
354-371 (18) TMILWAPDEESGVWLEQR PA
1
372-408 (37) EWTPEIVISGHFDGVQDLVWDPEGEFIITVGTDQTTR PA
6
417-437 (21) DQSQVTWHEIARPQIHGYDLK PA
6
445-454 (10) FQFVSGADEK PA
6
464-502 (39) NFVENFCAITGQSLNHVLCNQDSDLPEGATVPALGLSNK PA
6
503-557 (55) AVFQGDIASQPSDEEELLTSTGFEYQQVAFQPSILTEPPTEDHLLQNTLWPEVQK PA
6
558-574 (17) LYGHGYEIFCVTCNSSK PA
6
575-582 (8) TLLASACK PA
6
587-600 (14) EHAAIILWNTTSWK PA
6
601-622 (22) QVQNLVFHSLTVTQMAFSPNEK PA
6
639-658 (20) QDTISPEFEPVFSLFAFTNK PA
5
666-677 (12) IIWSCDWSPDSK PA
5
688-732 (45) VVVWGECDSTDDCIEHNIGPCSSVLDVGGAVTAVSVCPVLHPSQR PA
5
733-743 (11) YVVAVGLECGK PA
5
752-778 (27) TDQVPEINDWTHCVETSQSQSHTLAIR PA
5
793-812 (20) EAEGAEWLHFASCGEDHTVK PA
5
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center