Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6IA86-6)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MVAPVLETSHVFCCPNR PA
6
20-29 (10) GVLNWSSGPR PA
6
30-47 (18) GLLAFGTSCSVVLYDPLK PA
6
49-60 (12) VVVTNLNGHTAR PA
6
61-69 (9) VNCIQWICK PA
6
70-99 (30) QDGSPSTELVSGGSDNQVIHWEIEDNQLLK PA
6
100-119 (20) AVHLQGHEGPVYAVHAVYQR PA
6
121-140 (20) TSDPALCTLIVSAAADSAVR PA
6
146-178 (33) GPEVMCLQTLNFGNGFALALCLSFLPNTDVTWK PA
0
187-199 (13) AWKPPASLALCSR PA
1
200-214 (15) SCDSMVSCYASILCK PA
1
221-229 (9) LHTFWHHNR PA
1
230-251 (22) ISFLPSAFRPIPILACGNDDCR PA
1
252-264 (13) IHIFAQQNDQFQK PA
5
265-276 (12) VLSLCGHEDWIR PA
5
277-285 (9) GVEWAAFGR PA
5
286-299 (14) DLFLASCSQDCLIR PA
6
307-319 (13) STSLETQDDDNIR PA
6
322-333 (12) ENTFTIENESVK PA
6
334-362 (29) IAFAVTLETVLAGHENWVNAVHWQPVFYK PA
6
363-371 (9) DGVLQQPVR PA
6
372-379 (8) LLSASMDK PA
6
380-398 (19) TMILWAPDEESGVWLEQVR PA
4
399-434 (36) VGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWK PA
4
442-478 (37) EWTPEIVISGHFDGVQDLVWDPEGEFIITVGTDQTTR PA
6
487-507 (21) DQSQVTWHEIARPQIHGYDLK PA
6
515-524 (10) FQFVSGADEK PA
6
534-572 (39) NFVENFCAITGQSLNHVLCNQDSDLPEGATVPALGLSNK PA
6
573-627 (55) AVFQGDIASQPSDEEELLTSTGFEYQQVAFQPSILTEPPTEDHLLQNTLWPEVQK PA
6
628-644 (17) LYGHGYEIFCVTCNSSK PA
6
645-652 (8) TLLASACK PA
6
657-670 (14) EHAAIILWNTTSWK PA
6
671-692 (22) QVQNLVFHSLTVTQMAFSPNEK PA
6
709-728 (20) QDTISPEFEPVFSLFAFTNK PA
5
736-747 (12) IIWSCDWSPDSK PA
5
758-802 (45) VVVWGECDSTDDCIEHNIGPCSSVLDVGGAVTAVSVCPVLHPSQR PA
5
803-813 (11) YVVAVGLECGK PA
5
822-848 (27) TDQVPEINDWTHCVETSQSQSHTLAIR PA
5
863-882 (20) EAEGAEWLHFASCGEDHTVK PA
5
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center