Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6IA86-7)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MVAPVLETSHVFCCPNR PA
6
20-29 (10) GVLNWSSGPR PA
6
30-47 (18) GLLAFGTSCSVVLYDPLK PA
6
49-60 (12) VVVTNLNGHTAR PA
6
61-69 (9) VNCIQWICK PA
6
70-99 (30) QDGSPSTELVSGGSDNQVIHWEIEDNQLLK PA
6
100-119 (20) AVHLQGHEGPVYAVHAVYQR PA
6
121-140 (20) TSDPALCTLIVSAAADSAVR PA
6
151-164 (14) DLFLASCSQDCLIR PA
6
172-184 (13) STSLETQDDDNIR PA
6
187-198 (12) ENTFTIENESVK PA
6
199-227 (29) IAFAVTLETVLAGHENWVNAVHWQPVFYK PA
6
228-236 (9) DGVLQQPVR PA
6
237-244 (8) LLSASMDK PA
6
245-263 (19) TMILWAPDEESGVWLEQVR PA
4
264-299 (36) VGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWK PA
4
307-343 (37) EWTPEIVISGHFDGVQDLVWDPEGEFIITVGTDQTTR PA
6
352-372 (21) DQSQVTWHEIARPQIHGYDLK PA
6
380-389 (10) FQFVSGADEK PA
6
399-437 (39) NFVENFCAITGQSLNHVLCNQDSDLPEGATVPALGLSNK PA
6
438-492 (55) AVFQGDIASQPSDEEELLTSTGFEYQQVAFQPSILTEPPTEDHLLQNTLWPEVQK PA
6
493-509 (17) LYGHGYEIFCVTCNSSK PA
6
510-517 (8) TLLASACK PA
6
522-535 (14) EHAAIILWNTTSWK PA
6
536-557 (22) QVQNLVFHSLTVTQMAFSPNEK PA
6
574-593 (20) QDTISPEFEPVFSLFAFTNK PA
5
601-612 (12) IIWSCDWSPDSK PA
5
623-667 (45) VVVWGECDSTDDCIEHNIGPCSSVLDVGGAVTAVSVCPVLHPSQR PA
5
668-678 (11) YVVAVGLECGK PA
5
687-713 (27) TDQVPEINDWTHCVETSQSQSHTLAIR PA
5
728-747 (20) EAEGAEWLHFASCGEDHTVK PA
5
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center