Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6IC83-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-50 (46) LTCCLGPSGGLNCDCCRPDVGPCHECEIPETVAATAPASTTAKPAK PA
0
58-68 (11) AQLMQYLSLPK PA
0
94-130 (37) HGIWPLENIGPTEDVQASAHGGVEENMTSDIEIPEAK PA
0
131-161 (31) HDHRPTEDVQVSAHGGVEENITSDIEISEAK PA
0
162-220 (59) HDHHLVEDLSESLSVCLEDFMTSDLSESLSVSLEDFMTSGLSESLSVSLEDLMTPEMAK PA
0
223-231 (9) YEDYLCWVK PA
0
237-250 (14) LNEPISSQVLGLLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center