Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6IEY1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-80 (80) MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNILIVFSVTTDPHLHSPMYFLLASLSFIDLGACSVTSPK PA
0
91-122 (32) VISFGGCIAQIFFIHVVGGVEMVLLIAMAFDR PA
0
123-139 (17) YVALCKPLHYLTIMSPR PA
1
140-183 (44) MCLSFLAVAWTLGVSHSLFQLAFLVNLAFCGPNVLDSFYCDLPR PA
1
187-194 (8) LACTDTYR PA
4
195-227 (33) LQFMVTVNSGFICVGTFFILLISYVFILFTVWK PA
1
228-235 (8) HSSGGSSK PA
1
236-269 (34) ALSTLSAHSTVVLLFFGPPMFVYTRPHPNSQMDK PA
1
270-290 (21) FLAIFDAVLTPFLNPVVYTFR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center