Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6IF42-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-53 (53) MEGNQTWITDITLLGFQVGPALAILLCGLFSVFYTLTLLGNGVIFGIICLDSK PA
0
54-79 (26) LHTPMYFFLSHLAIIDMSYASNNVPK PA
0
80-88 (9) MLANLMNQK PA
0
90-121 (32) TISFVPCIMQTFLYLAFAVTECLILVVMSYDR PA
0
122-138 (17) YVAICHPFQYTVIMSWR PA
0
139-164 (26) VCTILVLTSWSCGFALSLVHEILLLR PA
0
172-185 (14) DVNHLFCEILSVLK PA
0
186-226 (41) LACADTWVNQVVIFATCVFVLVGPLSLILVSYMHILGAILK PA
0
236-266 (31) AFSTCSSHLCVVGLFFGIAMVVYMVPDSNQR PA
0
272-292 (21) MLSLFHSVFNPMLNPLIYSLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center