Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6NSI3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MVTLITEK PA
0
9-20 (12) LQSQSLDDLTCK PA
0
21-35 (15) AEAGPLQYSAETLNK PA
0
39-51 (13) LFPLELNDQSPWK PA
0
52-60 (9) VFSGGPPVR PA
0
61-118 (58) SQAATGPDFSFLPGLSAAAHTMGLQWQPQSPRPGAGLGAASTVDPSESTGSSTAPPTK PA
0
123-132 (10) SLSEPEELVR PA
0
135-143 (9) SPWRPGSSK PA
0
153-161 (9) CDSGGSATR PA
0
162-171 (10) QGSPGAVLPR PA
0
172-219 (48) SAVWSTGPTSPATPRPSSASGGFVDSSEGSAGSGPLWCSAESCLPSTR PA
0
221-228 (8) RPSLSQER PA
0
229-252 (24) LAGAGTPLPWASSSPTSTPALGGR PA
0
260-268 (9) SQPCVLSGK PA
0
282-291 (10) WTRPSLDFLK PA
0
301-318 (18) SLCSLNYEDDDEDDTPVK PA
0
319-328 (10) TVLSSPCDSR PA
0
329-341 (13) GLPGITMPGCSQR PA
0
345-356 (12) TSPVHPNLWASR PA
0
357-365 (9) ESVTSDGSR PA
0
373-385 (13) DGDSVGEEGVFPR PA
0
388-398 (11) WELDLEQIENN PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center