Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6NUQ1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-23 (23) MLPAGEIGASPAAPCCSESGDER PA
0
30-41 (12) SDINVTVLIGSK PA
0
42-62 (21) QVSEGTDNGDLPSYVSAFIEK PA
0
86-101 (16) MQLEEQVLTISSEIPK PA
0
115-157 (43) QFLNQFLEQETHLFSAINSHLLTAQPWMDDLGTMISQIEEIER PA
0
164-200 (37) WISQIEELSDNIQQYLMTNNVPEAASTLVSMAELDIK PA
0
201-214 (14) LQESSCTHLLGFMR PA
0
228-276 (49) LTSDFEEILAQLHWPFIAPPQSQTVGLSRPASAPEIYSYLETLFCQLLK PA
0
277-288 (12) LQTSDELLTEPK PA
0
294-315 (22) YSLPASPSVILPIQVMLTPLQK PA
0
326-354 (29) QTNVLSKPEWYLAQVLMWIGNHTEFLDEK PA
0
362-369 (8) VGSLVNAR PA
0
375-383 (9) GLMMLVLEK PA
0
384-410 (27) LATDIPCLLYDDNLFCHLVDEVLLFER PA
0
411-437 (27) ELHSVHGYPGTFASCMHILSEETCFQR PA
0
450-465 (16) MDSMLSSEAAWVSQYK PA
0
466-474 (9) DITDVDEMK PA
0
475-492 (18) VPDCAETFMTLLLVITDR PA
0
503-510 (8) LQFLELQK PA
0
536-578 (43) YCAILNAVNYISTVLADWADNVFFLQLQQAALEVFAENNTLSK PA
0
579-601 (23) LQLGQLASMESSVFDDMINLLER PA
0
630-656 (27) WLSLPSQSEQAVMSLSSSACPLLLTLR PA
0
657-672 (16) DHLLQLEQQLCFSLFK PA
0
673-681 (9) IFWQMLVEK PA
0
682-710 (29) LDVYIYQEIILANHFNEGGAAQLQFDMTR PA
0
711-721 (11) NLFPLFSHYCK PA
0
732-748 (17) EACIVLNLNVGSALLLK PA
0
749-771 (23) DVLQSASGQLPATAALNEVGIYK PA
0
772-784 (13) LAQQDVEILLNLR PA
0
785-792 (8) TNWPNTGK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center