Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6NXP6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MDMLQDLESLQFEYGVPEEDR PA
1
22-29 (8) IWLYLQGR PA
1
32-46 (15) GLMIEACAHATFFCK PA
1
63-78 (16) HLSIGSLNSATPEEFK PA
1
79-89 (11) VGIIGGGHLGK PA
1
90-107 (18) QLAGTLLQLGPIPAESLR PA
1
112-121 (10) RPETLGELQK PA
1
126-162 (37) CFYHNADLVSWADVIFLCCLPSQLPNICVEIYTSLEK PA
1
163-177 (15) ASIVYSFVAAIPLPR PA
1
180-206 (27) LLLNHTNILRPQYQYDEDSVSVWGANK PA
1
207-235 (29) GVIAALQDPTILQATCPYSPAGGIILNIK PA
0
236-251 (16) WLEGVFYAALNICTAR PA
0
252-276 (25) NMAHSQVLQLLSELFLSVHFEDCGK PA
0
284-292 (9) LQLTDFVSK PA
0
297-315 (19) NLSQERPFPWFDLTAVQLK PA
0
316-347 (32) ETPFSQHLSSSPVLQDHLTHLYCASFGISLTK PA
0
348-359 (12) EQPVISTGFPSQ PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center