Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6P1L6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MMLPYPSALGDQYWEEILLPK PA
1
22-30 (9) NGENVETMK PA
1
40-51 (12) GLPSNDTDCPQK PA
1
56-65 (10) AQIVVPVTFR PA
1
66-77 (12) DVTVIFTEAEWK PA
1
89-96 (8) EVMLENYR PA
8
97-152 (56) NLLSLAEPKPEIYTCSSCLLAFSCQQFLSQHVLQIFLGLCAENHFHPGNSSPGHWK PA
1
153-173 (21) QQGQQYSHVSCWFENAEGQER PA
1
174-183 (10) GGGSKPWSAR PA
1
192-199 (8) AFPSPLQR PA
1
207-228 (22) GNMVVETEPSSAQRPNPVQLDK PA
1
245-261 (17) EYEPDHNLESNFITNPR PA
1
267-276 (10) KPYICSDCGR PA
1
290-304 (15) IHSMEKPYVCSECGR PA
1
318-328 (11) THSEEKPYLCR PA
1
343-360 (18) HQWTHSEEKPYVCSECGR PA
1
374-388 (15) THSGEKPYVCLECGR PA
1
402-412 (11) IHSGEKPYVCR PA
1
417-426 (10) GFSQNSDLIK PA
1
430-440 (11) THLDEKPYVCR PA
1
450-457 (8) STLIIHER PA
6
458-472 (15) THSGEKPYVCGECGR PA
1
478-485 (8) SLLLVHQR PA
1
514-524 (11) THSNEKPYICR PA
1
534-541 (8) STLIVHER PA
1
542-556 (15) THSGEKPYVCSECGR PA
1
562-569 (8) SLLLVHQR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center