Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6P1L6-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-62 (56) NLLSLAEPKPEIYTCSSCLLAFSCQQFLSQHVLQIFLGLCAENHFHPGNSSPGHWK PA
1
63-83 (21) QQGQQYSHVSCWFENAEGQER PA
1
84-93 (10) GGGSKPWSAR PA
1
102-109 (8) AFPSPLQR PA
1
117-138 (22) GNMVVETEPSSAQRPNPVQLDK PA
1
155-171 (17) EYEPDHNLESNFITNPR PA
1
177-186 (10) KPYICSDCGR PA
1
200-214 (15) IHSMEKPYVCSECGR PA
1
228-238 (11) THSEEKPYLCR PA
1
253-270 (18) HQWTHSEEKPYVCSECGR PA
1
284-298 (15) THSGEKPYVCLECGR PA
1
312-322 (11) IHSGEKPYVCR PA
1
327-336 (10) GFSQNSDLIK PA
1
340-350 (11) THLDEKPYVCR PA
1
360-367 (8) STLIIHER PA
6
368-382 (15) THSGEKPYVCGECGR PA
1
388-395 (8) SLLLVHQR PA
1
424-434 (11) THSNEKPYICR PA
1
444-451 (8) STLIVHER PA
1
452-466 (15) THSGEKPYVCSECGR PA
1
472-479 (8) SLLLVHQR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center