Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6P2Q9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MAGVFPYR PA
0
9-29 (21) GPGNPVPGPLAPLPDYMSEEK PA
0
51-58 (8) FGFVDAQK PA
0
59-67 (9) EDMPPEHVR PA
0
72-79 (8) DHGDMTNR PA
0
94-101 (8) YMPHAVLK PA
0
102-114 (13) LLENMPMPWEQIR PA
0
115-152 (38) DVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMR PA
0
166-214 (49) FPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLR PA
0
219-227 (9) YVNGSTYQR PA
0
228-240 (13) WQFTLPMMSTLYR PA
0
241-261 (21) LANQLLTDLVDDNYFYLFDLK PA
0
268-278 (11) ALNMAIPGGPK PA
0
285-301 (17) DINLQDEDWNEFNDINK PA
0
314-341 (28) IAFPYLYNNLPHHVHLTWYHTPNVVFIK PA
0
342-362 (21) TEDPDLPAFYFDPLINPISHR PA
0
367-389 (23) SQEPLPDDDEEFELPEFVEPFLK PA
0
390-414 (25) DTPLYTDNTANGIALLWAPRPFNLR PA
0
421-428 (8) ALDIPLVK PA
0
433-442 (10) EHCPAGQPVK PA
0
453-460 (8) YYVLNALK PA
0
487-498 (12) LDWVEVGLQVCR PA
0
499-510 (12) QGYNMLNLLIHR PA
0
512-528 (17) NLNYLHLDYNFNLKPVK PA
0
540-548 (9) FGNAFHLCR PA
0
556-565 (10) LVVDSHVQYR PA
0
566-593 (28) LGNVDAFQLADGLQYIFAHVGQLTGMYR PA
0
616-623 (8) FNTGPVGK PA
0
624-635 (12) GPGCGFWAAGWR PA
0
643-650 (8) GITPLLER PA
0
651-658 (8) WLGNLLAR PA
0
677-686 (10) VESHFDLELR PA
0
687-702 (16) AAVMHDILDMMPEGIK PA
0
708-718 (11) TILQHLSEAWR PA
0
728-741 (14) VPGLPTPIENMILR PA
0
747-758 (12) ADWWTNTAHYNR PA
0
797-820 (24) DGPYITAEEAVAVYTTTVHWLESR PA
0
822-833 (12) FSPIPFPPLSYK PA
0
838-845 (8) LLILALER PA
0
862-880 (19) EELGLIEQAYDNPHEALSR PA
0
893-916 (24) EVGIEFMDLYSHLVPVYDVEPLEK PA
0
917-932 (16) ITDAYLDQYLWYEADK PA
0
935-954 (20) LFPPWIKPADTEPPPLLVYK PA
0
955-980 (26) WCQGINNLQDVWETSEGECNVMLESR PA
0
988-995 (8) IDLTLLNR PA
0
999-1012 (14) LIVDHNIADYMTAK PA
0
1013-1020 (8) NNVVINYK PA
0
1021-1032 (12) DMNHTNSYGIIR PA
0
1033-1057 (25) GLQFASFIVQYYGLVMDLLVLGLHR PA
0
1058-1086 (29) ASEMAGPPQMPNDFLSFQDIATEAAHPIR PA
0
1113-1131 (19) YLTEHPDPNNENIVGYNNK PA
0
1164-1180 (17) SVTTVQWENSFVSVYSK PA
0
1181-1195 (15) DNPNLLFNMCGFECR PA
0
1202-1210 (9) TSYEEFTHK PA
0
1211-1222 (12) DGVWNLQNEVTK PA
0
1232-1239 (8) VDDESMQR PA
0
1246-1258 (13) QILMASGSTTFTK PA
0
1263-1275 (13) WNTALIGLMTYFR PA
0
1276-1290 (15) EAVVNTQELLDLLVK PA
0
1311-1320 (10) FPPVVFYTPK PA
0
1321-1341 (21) ELGGLGMLSMGHVLIPQSDLR PA
0
1345-1354 (10) QTDVGITHFR PA
0
1355-1370 (16) SGMSHEEDQLIPNLYR PA
0
1371-1384 (14) YIQPWESEFIDSQR PA
0
1385-1392 (8) VWAEYALK PA
0
1394-1401 (8) QEAIAQNR PA
0
1403-1414 (12) LTLEDLEDSWDR PA
0
1450-1459 (10) QNPFWWTHQR PA
0
1464-1471 (8) LWNLNNYR PA
0
1472-1491 (20) TDMIQALGGVEGILEHTLFK PA
0
1492-1505 (14) GTYFPTWEGLFWEK PA
0
1506-1514 (9) ASGFEESMK PA
0
1524-1532 (9) SGLNQIPNR PA
0
1534-1544 (11) FTLWWSPTINR PA
0
1545-1565 (21) ANVYVGFQVQLDLTGIFMHGK PA
0
1571-1578 (8) ISLIQIFR PA
0
1585-1611 (27) IHESIVMDLCQVFDQELDALEIETVQK PA
0
1622-1636 (15) MNSSCADILLFASYK PA
0
1637-1649 (13) WNVSRPSLLADSK PA
0
1650-1659 (10) DVMDSTTTQK PA
0
1660-1667 (8) YWIDIQLR PA
0
1668-1678 (11) WGDYDSHDIER PA
0
1684-1732 (49) FLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAK PA
0
1736-1744 (9) ANPALYVLR PA
0
1750-1787 (38) GLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYR PA
0
1793-1813 (21) TFEGNLTTKPINGAIFIFNPR PA
0
1821-1831 (11) IIHTSVWAGQK PA
0
1841-1850 (10) TAEEVAALIR PA
0
1851-1859 (9) SLPVEEQPK PA
0
1867-1885 (19) GMLDPLEVHLLDFPNIVIK PA
0
1886-1898 (13) GSELQLPFQACLK PA
0
1909-1925 (17) ATEPQMVLFNLYDDWLK PA
0
1926-1935 (10) TISSYTAFSR PA
0
1942-1949 (8) ALHVNNDR PA
0
1959-1978 (20) TTITEPHHIWPTLTDEEWIK PA
0
1985-1993 (9) DLILADYGK PA
0
1995-2008 (14) NNVNVASLTQSEIR PA
0
2009-2023 (15) DIILGMEISAPSQQR PA
0
2024-2031 (8) QQIAEIEK PA
0
2035-2045 (11) EQSQLTATQTR PA
0
2050-2070 (21) HGDEIITSTTSNYETQTFSSK PA
0
2077-2086 (10) AISAANLHLR PA
0
2087-2098 (12) TNHIYVSSDDIK PA
0
2099-2108 (10) ETGYTYILPK PA
0
2114-2121 (8) FICISDLR PA
0
2122-2140 (19) AQIAGYLYGVSPPDNPQVK PA
0
2144-2170 (27) CIVMVPQWGTHQTVHLPGQLPQHEYLK PA
0
2171-2198 (28) EMEPLGWIHTQPNESPQLSPQDVTTHAK PA
0
2199-2210 (12) IMADNPSWDGEK PA
0
2211-2229 (19) TIIITCSFTPGSCTLTAYK PA
0
2230-2239 (10) LTPSGYEWGR PA
0
2250-2258 (9) GYLPSHYER PA
0
2259-2266 (8) VQMLLSDR PA
0
2267-2287 (21) FLGFFMVPAQSSWNYNFMGVR PA
0
2294-2302 (9) YELQLANPK PA
0
2303-2330 (28) EFYHEVHRPSHFLNFALLQEGEVYSADR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center