Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6Q0C0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
12-29 (18) FSGGPSNLPTPDVTTGTR PA
0
30-46 (17) METTFGPAFSAVTTITK PA
0
47-54 (8) ADGTSTYK PA
0
59-71 (13) TPSSSSTLAYSPR PA
0
72-84 (13) DEEDSMPPISTPR PA
0
86-93 (8) SDSAISVR PA
1
94-104 (11) SLHSESSMSLR PA
1
105-128 (24) STFSLPEEEEEPEPLVFAEQPSVK PA
1
129-139 (11) LCCQLCCSVFK PA
1
140-152 (13) DPVITTCGHTFCR PA
1
168-189 (22) LTVVVNNIAVAEQIGELFIHCR PA
1
194-208 (15) VAGSGKPPIFEVDPR PA
1
221-232 (12) DHEGSCDYRPVR PA
1
233-244 (12) CPNNPSCPPLLR PA
1
245-252 (8) MNLEAHLK PA
1
264-283 (20) YGCTFIGNQDTYETHLETCR PA
1
289-297 (9) EFLQQTDDR PA
1
298-308 (11) FHEMHVALAQK PA
1
309-316 (8) DQEIAFLR PA
1
337-346 (10) FDVLDENQSK PA
1
347-355 (9) LSEDLMEFR PA
1
357-371 (15) DASMLNDELSHINAR PA
1
372-387 (16) LNMGILGSYDPQQIFK PA
1
390-418 (29) GTFVGHQGPVWCLCVYSMGDLLFSGSSDK PA
1
422-430 (9) VWDTCTTYK PA
1
434-451 (18) TLEGHDGIVLALCIQGCK PA
1
452-471 (20) LYSGSADCTIIVWDIQNLQK PA
1
477-498 (22) AHDNPVCTLVSSHNVLFSGSLK PA
1
502-511 (10) VWDIVGTELK PA
1
515-524 (10) ELTGLNHWVR PA
1
525-542 (18) ALVAAQSYLYSGSYQTIK PA
1
548-589 (42) TLDCIHVLQTSGGSVYSIAVTNHHIVCGTYENLIHVWDIESK PA
1
594-615 (22) TLTGHVGTVYALAVISTPDQTK PA
1
616-623 (8) VFSASYDR PA
1
627-641 (15) VWSMDNMICTQTLLR PA
1
642-653 (12) HQGSVTALAVSR PA
1
656-666 (11) LFSGAVDSTVK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center