Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6Q0C0-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MPPISTPR PA
0
10-17 (8) SDSAISVR PA
1
18-28 (11) SLHSESSMSLR PA
1
29-52 (24) STFSLPEEEEEPEPLVFAEQPSVK PA
1
53-63 (11) LCCQLCCSVFK PA
1
64-76 (13) DPVITTCGHTFCR PA
1
92-113 (22) LTVVVNNIAVAEQIGELFIHCR PA
1
118-132 (15) VAGSGKPPIFEVDPR PA
1
145-156 (12) DHEGSCDYRPVR PA
1
157-168 (12) CPNNPSCPPLLR PA
1
169-176 (8) MNLEAHLK PA
1
188-207 (20) YGCTFIGNQDTYETHLETCR PA
1
213-221 (9) EFLQQTDDR PA
1
222-232 (11) FHEMHVALAQK PA
1
233-240 (8) DQEIAFLR PA
1
261-270 (10) FDVLDENQSK PA
1
271-279 (9) LSEDLMEFR PA
1
281-295 (15) DASMLNDELSHINAR PA
1
296-311 (16) LNMGILGSYDPQQIFK PA
1
314-342 (29) GTFVGHQGPVWCLCVYSMGDLLFSGSSDK PA
1
346-354 (9) VWDTCTTYK PA
1
358-375 (18) TLEGHDGIVLALCIQGCK PA
1
376-395 (20) LYSGSADCTIIVWDIQNLQK PA
1
401-422 (22) AHDNPVCTLVSSHNVLFSGSLK PA
1
426-435 (10) VWDIVGTELK PA
1
439-448 (10) ELTGLNHWVR PA
1
449-466 (18) ALVAAQSYLYSGSYQTIK PA
1
472-513 (42) TLDCIHVLQTSGGSVYSIAVTNHHIVCGTYENLIHVWDIESK PA
1
518-539 (22) TLTGHVGTVYALAVISTPDQTK PA
1
540-547 (8) VFSASYDR PA
1
551-565 (15) VWSMDNMICTQTLLR PA
1
566-577 (12) HQGSVTALAVSR PA
1
580-590 (11) LFSGAVDSTVK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center