Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6Q0C1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-24 (24) MDFVAGAIGGVCGVAVGYPLDTVK PA
1
33-41 (9) YTGIWHCVR PA
0
55-75 (21) GLSLPVCTVSLVSSVSFGTYR PA
0
76-83 (8) HCLAHICR PA
0
86-95 (10) YGNPDAKPTK PA
0
96-109 (14) ADITLSGCASGLVR PA
0
110-120 (11) VFLTSPTEVAK PA
0
123-131 (9) LQTQTQAQK PA
0
136-158 (23) LSASGPLAVPPMCPVPPACPEPK PA
0
161-171 (11) GPLHCLATVAR PA
0
172-180 (9) EEGLCGLYK PA
0
181-188 (8) GSSALVLR PA
0
189-242 (54) DGHSFATYFLSYAVLCEWLSPAGHSRPDVPGVLVAGGCAGVLAWAVATPMDVIK PA
0
245-253 (9) LQADGQGQR PA
0
257-267 (11) GLLHCMVTSVR PA
0
277-284 (8) GLVLNCCR PA
0
285-301 (17) AFPVNMVVFVAYEAVLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center