Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6RFH5-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-21 (14) WNHVWVGTETGILK PA
1
29-40 (12) QAANFTAGGQPR PA
1
42-65 (24) EEAVSALCWGTGGETQMLVGCADR PA
1
69-81 (13) HFSTEDGIFQGQR PA
1
82-91 (10) HCPGGEGMFR PA
1
92-110 (19) GLAQADGTLITCVDSGILR PA
1
118-128 (11) DTSSDPLLELR PA
1
138-151 (14) QDPAHPHVVATGGK PA
1
157-169 (13) IWDLQGSEEPVFR PA
1
182-197 (16) VPIWDQDIQFLPGSQK PA
1
198-208 (11) LVTCTGYHQVR PA
1
209-217 (9) VYDPASPQR PA
1
218-257 (40) RPVLETTYGEYPLTAMTLTPGGNSVIVGNTHGQLAEIDLR PA
1
274-291 (18) GLQCHPSKPLLASCGLDR PA
1
312-322 (11) SQLNCLLLSGR PA
0
323-337 (15) DNWEDEPQEPQEPNK PA
0
338-357 (20) VPLEDTETDELWASLEAAAK PA
1
360-373 (14) LSGLEQPQGALQTR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center