Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6RW13-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MELPAVNLK PA
4
10-48 (39) VILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQR PA
1
49-78 (30) DSIDAISMFLGGLLATIFLDIVHISIFYPR PA
1
79-86 (8) VSLTDTGR PA
1
87-111 (25) FGVGMAILSLLLKPLSCCFVYHMYR PA
1
114-130 (17) GGELLVHTGFLGSSQDR PA
0
131-152 (22) SAYQTIDSAEAPADPFAVPEGR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center