Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6S5H5-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-15 (15) MVAEAGSMPAASSVK PA
5
41-55 (15) SNVGTSGDHDDSAMK PA
10
78-92 (15) SNVGTSGDHDDSAMK PA
10
101-110 (10) WCCHCFPCCR PA
17
117-132 (16) VGPWGDYDDSAFMEPR PA
5
175-190 (16) TALHLASANGNSEVVK PA
9
197-205 (9) CQLNILDNK PA
5
218-252 (35) EDECALMLLEHGTDPNIPDEYGNTALHYAIYNEDK PA
2
257-268 (12) ALLLYGADIESK PA
16
271-322 (52) IESHSVSQAGVQWCDHSSLQPRPPEAQMVLQPQPQLFFSFFLFIFIFIFIFF PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center