Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6UB98-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-28 (25) SGFTKPIQSENSDSDSNMVEKPYGR PA
1
62-70 (9) LPFTISPSR PA
1
75-92 (18) DSDTDSDPGHTSENWGER PA
0
120-134 (15) STPVSILFGYPLSER PA
1
136-146 (11) QMALLMQMTAR PA
1
147-165 (19) DNSPDSTPNHPSQTTPAQK PA
1
185-195 (11) GETPLHMAAIR PA
1
203-214 (12) ELISLGANVNVK PA
1
215-235 (21) DFAGWTPLHEACNVGYYDVAK PA
1
236-264 (29) ILIAAGADVNTQGLDDDTPLHDSASSGHR PA
1
273-282 (10) HGGNPFQANK PA
1
283-301 (19) HGERPVDVAETEELELLLK PA
1
303-337 (35) EVPLSDDDESYTDSEEAQSVNPSSVDENIDSETEK PA
1
338-345 (8) DSLICESK PA
1
352-364 (13) TPLPSALDEYEFK PA
1
365-373 (9) DDDDEEINK PA
1
388-395 (8) ENEPEAEK PA
1
421-437 (17) VLYSSTESSDEEALQNK PA
1
439-457 (19) ISTSCSVIPETSNSDMQTK PA
1
459-467 (9) EYVVSGEHK PA
1
500-514 (15) ITNLTVNTGLDCSEK PA
1
529-542 (14) DDTSLHLFHISTGK PA
1
546-553 (8) HSCGLSEK PA
1
565-582 (18) TCLSPGSSEMSLQPDLVR PA
1
583-598 (16) YDNTESEFLPESSSVK PA
1
611-619 (9) DFHLEFGEK PA
1
626-641 (16) DEDHSPTFENSDCTLK PA
1
703-722 (20) SDETEDLFLNMEHESLTLEK PA
1
782-804 (23) DSEFTSLGMSAIEESIGLHLVEK PA
1
858-866 (9) LDLSECVDK PA
1
873-880 (8) LYSHHTEK PA
1
937-945 (9) QSDNSEYSK PA
1
968-976 (9) ESINITNSK PA
1
984-991 (8) SSIVDGNK PA
1
992-1001 (10) AQHEKPLSLK PA
1
1037-1044 (8) IQINSLLK PA
1
1047-1055 (9) SEADKPKPK PA
1
1070-1082 (13) LVNDDLMQTSFER PA
1
1088-1096 (9) DLEIEQWHK PA
1
1143-1152 (10) SSEVTDAYTK PA
1
1178-1188 (11) SSFVSDNSLNR PA
1
1192-1202 (11) SENEKPGLSSR PA
1
1203-1254 (52) SVSMISVASSEDSCHTTVTTPRPPVEYDSDFMLESSESQMSFSQSPFLSIAK PA
1
1262-1272 (11) ELDSLADLPER PA
1
1273-1280 (8) IKPPYANR PA
1
1288-1295 (8) SSSVEDVK PA
1
1296-1308 (13) LIISEGRPTIEVR PA
1
1310-1321 (12) CSMPSVICEHTK PA
1
1322-1357 (36) QFQTISEESNQGSLLTVPGDTSPSPKPEVFSNVPER PA
1
1358-1380 (23) DLSNVSNIHSSFATSPTGASNSK PA
1
1391-1417 (27) NTAPVNTVMDSPVHLEPSSQVGVIQNK PA
1
1418-1425 (8) SWEMPVDR PA
1
1433-1457 (25) DFICPNSNIPDQESSLQSFCNSENK PA
1
1461-1469 (9) ENADFLSLR PA
1
1470-1507 (38) QTELPGNSCAQDPASFMPPQQPCSFPSQSLSDAESISK PA
1
1508-1525 (18) HMSLSYVANQEPGILQQK PA
1
1526-1543 (18) NAVQIISSALDTDNESTK PA
1
1544-1556 (13) DTENTFVLGDVQK PA
1
1557-1578 (22) TDAFVPVYSDSTIQEASPNFEK PA
1
1579-1589 (11) AYTLPVLPSEK PA
1
1590-1608 (19) DFNGSDASTQLNTHYAFSK PA
1
1613-1633 (21) SSSGHEVENSTTDTQVISHEK PA
1
1637-1647 (11) LESLVLTHLSR PA
1
1648-1661 (14) CDSDLCEMNAGMPK PA
1
1662-1670 (9) GNLNEQDPK PA
1
1678-1709 (32) CLLSIEDEESQQSILSSLENHSQQSTQPEMHK PA
1
1716-1726 (11) VELEENAEDDK PA
1
1727-1734 (8) TENQIPQR PA
1
1740-1748 (9) ANTMANQSK PA
1
1749-1760 (12) QILASCTLLSEK PA
1
1761-1768 (8) DSESSSPR PA
1
1773-1785 (13) LTEDDDPQIHHPR PA
1
1792-1806 (15) VPQPVQVSPSLLQAK PA
1
1809-1821 (13) TQQSLAAIVDSLK PA
1
1822-1832 (11) LDEIQPYSSER PA
1
1833-1843 (11) ANPYFEYLHIR PA
1
1852-1883 (32) LLCSVIPQAPQYYDEYVTFNGSYLLDGNPLSK PA
1
1884-1900 (17) ICIPTITPPPSLSDPLK PA
1
1924-1934 (11) LIVSNEQEVLR PA
1
1942-1974 (33) TLANQTLPFSACTVLLDAEVYNVPLDSQSDDSK PA
1
1985-1996 (12) QFMSWLQDVDDK PA
1
2008-2020 (13) QQHEAAALNAVQR PA
2
2027-2036 (10) LQELDPATYK PA
1
2037-2062 (26) SISIYEIQEFYVPLVDVNDDFELTPI PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center