Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6UB98-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-28 (25) SGFTKPIQSENSDSDSNMVEKPYGR PA
1
62-70 (9) LPFTISPSR PA
1
97-111 (15) STPVSILFGYPLSER PA
1
113-123 (11) QMALLMQMTAR PA
1
124-142 (19) DNSPDSTPNHPSQTTPAQK PA
1
162-172 (11) GETPLHMAAIR PA
1
180-191 (12) ELISLGANVNVK PA
1
192-212 (21) DFAGWTPLHEACNVGYYDVAK PA
1
213-241 (29) ILIAAGADVNTQGLDDDTPLHDSASSGHR PA
1
250-259 (10) HGGNPFQANK PA
1
260-278 (19) HGERPVDVAETEELELLLK PA
1
280-314 (35) EVPLSDDDESYTDSEEAQSVNPSSVDENIDSETEK PA
1
315-322 (8) DSLICESK PA
1
329-341 (13) TPLPSALDEYEFK PA
1
342-350 (9) DDDDEEINK PA
1
365-372 (8) ENEPEAEK PA
1
398-414 (17) VLYSSTESSDEEALQNK PA
1
416-434 (19) ISTSCSVIPETSNSDMQTK PA
1
436-444 (9) EYVVSGEHK PA
1
477-491 (15) ITNLTVNTGLDCSEK PA
1
506-519 (14) DDTSLHLFHISTGK PA
1
523-530 (8) HSCGLSEK PA
1
542-559 (18) TCLSPGSSEMSLQPDLVR PA
1
560-575 (16) YDNTESEFLPESSSVK PA
1
588-596 (9) DFHLEFGEK PA
1
603-618 (16) DEDHSPTFENSDCTLK PA
1
680-699 (20) SDETEDLFLNMEHESLTLEK PA
1
759-781 (23) DSEFTSLGMSAIEESIGLHLVEK PA
1
835-843 (9) LDLSECVDK PA
1
850-857 (8) LYSHHTEK PA
1
914-922 (9) QSDNSEYSK PA
1
945-953 (9) ESINITNSK PA
1
961-968 (8) SSIVDGNK PA
1
969-978 (10) AQHEKPLSLK PA
1
1014-1021 (8) IQINSLLK PA
1
1024-1032 (9) SEADKPKPK PA
1
1047-1059 (13) LVNDDLMQTSFER PA
1
1065-1073 (9) DLEIEQWHK PA
1
1120-1129 (10) SSEVTDAYTK PA
1
1155-1165 (11) SSFVSDNSLNR PA
1
1169-1179 (11) SENEKPGLSSR PA
1
1180-1231 (52) SVSMISVASSEDSCHTTVTTPRPPVEYDSDFMLESSESQMSFSQSPFLSIAK PA
1
1239-1249 (11) ELDSLADLPER PA
1
1250-1257 (8) IKPPYANR PA
1
1265-1272 (8) SSSVEDVK PA
1
1273-1285 (13) LIISEGRPTIEVR PA
1
1287-1298 (12) CSMPSVICEHTK PA
1
1299-1334 (36) QFQTISEESNQGSLLTVPGDTSPSPKPEVFSNVPER PA
1
1335-1357 (23) DLSNVSNIHSSFATSPTGASNSK PA
1
1368-1394 (27) NTAPVNTVMDSPVHLEPSSQVGVIQNK PA
1
1395-1402 (8) SWEMPVDR PA
1
1410-1434 (25) DFICPNSNIPDQESSLQSFCNSENK PA
1
1438-1446 (9) ENADFLSLR PA
1
1447-1484 (38) QTELPGNSCAQDPASFMPPQQPCSFPSQSLSDAESISK PA
1
1485-1502 (18) HMSLSYVANQEPGILQQK PA
1
1503-1520 (18) NAVQIISSALDTDNESTK PA
1
1521-1533 (13) DTENTFVLGDVQK PA
1
1534-1555 (22) TDAFVPVYSDSTIQEASPNFEK PA
1
1556-1566 (11) AYTLPVLPSEK PA
1
1567-1585 (19) DFNGSDASTQLNTHYAFSK PA
1
1590-1610 (21) SSSGHEVENSTTDTQVISHEK PA
1
1614-1624 (11) LESLVLTHLSR PA
1
1625-1638 (14) CDSDLCEMNAGMPK PA
1
1639-1647 (9) GNLNEQDPK PA
1
1655-1686 (32) CLLSIEDEESQQSILSSLENHSQQSTQPEMHK PA
1
1693-1703 (11) VELEENAEDDK PA
1
1704-1711 (8) TENQIPQR PA
1
1717-1725 (9) ANTMANQSK PA
1
1726-1737 (12) QILASCTLLSEK PA
1
1738-1745 (8) DSESSSPR PA
1
1750-1762 (13) LTEDDDPQIHHPR PA
1
1769-1783 (15) VPQPVQVSPSLLQAK PA
1
1786-1798 (13) TQQSLAAIVDSLK PA
1
1799-1809 (11) LDEIQPYSSER PA
1
1810-1820 (11) ANPYFEYLHIR PA
1
1829-1860 (32) LLCSVIPQAPQYYDEYVTFNGSYLLDGNPLSK PA
1
1861-1877 (17) ICIPTITPPPSLSDPLK PA
1
1901-1911 (11) LIVSNEQEVLR PA
1
1919-1951 (33) TLANQTLPFSACTVLLDAEVYNVPLDSQSDDSK PA
1
1962-1973 (12) QFMSWLQDVDDK PA
1
1985-1997 (13) QQHEAAALNAVQR PA
2
2004-2013 (10) LQELDPATYK PA
1
2014-2039 (26) SISIYEIQEFYVPLVDVNDDFELTPI PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center