Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6UW56-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
12-48 (37) GTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLK PA
2
49-56 (8) GDLANTFR PA
2
57-95 (39) GFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQK PA
2
96-133 (38) NLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYK PA
2
137-165 (29) QGSFSLLMFFGILGATTLSVSILLWATQR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center