Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6UXH0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-54 (54) MPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYR PA
0
65-72 (8) NSLGLYGR PA
0
73-83 (11) TIELLGQEVSR PA
0
93-124 (32) ASLLETQMEEDILQLQAEATAEVLGEVAQAQK PA
0
139-147 (9) SAWLGPAYR PA
0
159-172 (14) QSHILWALTGHVQR PA
0
176-183 (8) EMVAQQHR PA
0
191-198 (8) LHTAALPA PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center