Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6UXN2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-30 (30) MAWGGVHTCCFHLCCCCSWPQGAVPEELHK PA
0
31-45 (15) HPGQTLLLQCQYSPK PA
0
53-62 (10) SWCQQTSPSR PA
0
63-78 (16) CTLLVTSSKPWTAVQK PA
0
79-123 (45) SHYTIWDKPNAGFFNITMIQLTQNDSGFYWCGIYNASENIITVLR PA
0
124-169 (46) NISLVVSPAPTTSPMWTLPWLPTSTVLITSPEGTSGHPSINGSETR PA
0
173-183 (11) APACLGSGGPR PA
0
184-196 (13) FLVLVLCGLLLAK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center