Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6X9E4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
13-30 (18) IFSFLDLFGLLQVSQVNK PA
1
35-43 (9) IADSDYLWR PA
2
50-66 (17) WDCSNFTNQHLGTHTWK PA
2
79-90 (12) LALAQPHNFIYK PA
2
94-108 (15) NIAFETELAYLSGNR PA
2
109-116 (8) LTVDEQEK PA
2
117-125 (9) SIICSVSPK PA
2
126-166 (41) QELCAWDVQEGTMIWSSPVQEFHFSNLVTLPQMHLAITMDR PA
1
179-199 (21) DALAVLPMPQPCYCMEAYLTK PA
1
200-222 (23) DGPFLMVGDAAGDIYTFTLPGLR PA
1
227-243 (17) VTAFQYGIVLLHCSPDK PA
2
245-254 (10) WVFACGTYSR PA
2
255-282 (28) TLPQVFLTESLLRPSEGSVPLSTFLPHK PA
2
283-292 (10) LCASACWTPK PA
2
297-307 (11) ITLMSQSSTGK PA
2
309-319 (11) TEFITFDLTTK PA
2
321-342 (22) TGGQTVIQAYEIASFQVAAHLK PA
2
343-375 (33) CPIWMGASDGYMIVFTSGPYLLLFSITGFLLQR PA
2
376-411 (36) FEDHQAAINNFWVDPCYVLTTSENSVHVYMWEEGGR PA
2
417-447 (31) SCCHLENTWHDHTTDSCISSVMCDNASIVLR PA
2
451-464 (14) VSDSSILVMYSLNT PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center